PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400000026
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 169aa    MW: 19438.6 Da    PI: 10.6115
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400000026genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.69.2e-301059251
                          ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          rien++ rqvtfskRrng+lKKA+ELSvLCdaev +iifs++gklye++s
  PGSC0003DMP400000026 10 RIENTTSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIIFSPRGKLYEFAS 59
                          8***********************************************86 PP

2K-box72.41.4e-2482159986
                 K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                           +++ + ++ +qe a L k+ie L++++R+llGe+L+s+sl+e qq+e+qLe+s+++iR++K+++++eq+e+l+++ + 
  PGSC0003DMP400000026  82 NQSVDIQNNKQETASLMKKIELLESSKRKLLGEGLGSCSLEEVQQIEKQLEQSVTTIRARKMQVFREQMERLKERVRL 159
                           677889*******************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.553161IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-33386IPR002100Transcription factor, MADS-box
CDDcd002652.21E-41375No hitNo description
PfamPF003196.6E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-2285159IPR002487Transcription factor, K-box
PROSITE profilePS5129713.0787168IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MVRGKTQMRR IENTTSRQVT FSKRRNGLLK KAFELSVLCD AEVGLIIFSP RGKLYEFASS  60
SVPEVIERYK RHTKDKVQPD VNQSVDIQNN KQETASLMKK IELLESSKRK LLGEGLGSCS  120
LEEVQQIEKQ LEQSVTTIRA RKMQVFREQM ERLKERVRLV ALSQFIHA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-19372271Myocyte-specific enhancer factor 2A
3mu6_C2e-19372271Myocyte-specific enhancer factor 2A
3mu6_B2e-19372271Myocyte-specific enhancer factor 2A
3mu6_A2e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6644491e-145EU664449.1 Physalis pubescens MADS-box transcription factor PFSOC1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339503.11e-109PREDICTED: MADS-box protein SOC1-like isoform X1
RefseqXP_015167027.11e-109PREDICTED: MADS-box protein SOC1-like isoform X1
SwissprotO646459e-78SOC1_ARATH; MADS-box protein SOC1
TrEMBLM0ZFZ81e-119M0ZFZ8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000000281e-108(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-67AGAMOUS-like 20
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]